PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C04090.1.p
Common NameEUGRSUZ_C04090, LOC104438439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 825aa    MW: 94820.8 Da    PI: 7.1434
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C04090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR188.78e-2861148191
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                       +fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++    ++r+ ++++t+Cka+++vk+++dgkw +++++++HnHel p
  Eucgr.C04090.1.p  61 SFYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGVTPESESG---SSRRPSVKKTDCKASMHVKRRTDGKWIIHEFVKDHNHELLP 148
                       5***************************************9999877...77888899******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-2561148IPR004330FAR1 DNA binding domain
PfamPF105511.9E-22268361IPR018289MULE transposase domain
PROSITE profilePS509669.26548584IPR007527Zinc finger, SWIM-type
PfamPF044348.1E-5554581IPR007527Zinc finger, SWIM-type
SMARTSM005751.8E-6559586IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MDTRDGVQSG AGENMVSGTD EVQNRGSDFT PSETAVTGFE GDIDFEPRNG IEFDSHEAAY  60
SFYQEYAKSM GFTTSIKNSR RSKKSKEFID AKFACSRYGV TPESESGSSR RPSVKKTDCK  120
ASMHVKRRTD GKWIIHEFVK DHNHELLPAL AYHFRIHRNI KLAEKNNIDI LHAVSERTRK  180
MYVEMSRQSA GHPHACALHD KNDHQPDKGR SLTLDEGDGQ IILEYFKHIQ KENPSFFYAI  240
DLNEEQRLRN LLWVDAKSRN DYASFNDVVS LDTSYVKSND KFPFVPFVGV NHHSQTMLLG  300
CALIADKTRS TFVWLLKTWL RAMGGNSPSV ILSYQDKCLK EAIEEVLPQT RHCYLLWHIL  360
EKVHENLSHV INNHENFLSK FNKCIFKSWT DEQFDMRWWK MVSRFELQED EWVQMLYMER  420
KKWVPALLGE SFLAGMSTAQ RVDSMNSFFD RYIHKKITVK EFLRQYGVIL HNRCEEEAVA  480
DFDTWHKQPA LKSPSPWEKQ LSTVYTHAIF RKFQIEVLGV VACHPRKESE DGGTVIYRVE  540
DFEKKEYFMV TWNEVESEVS CFCHLFEYHG FLCRHAMVVL QISGFPSIPS RYIMKRWTKD  600
AKSRHSPDEG TKKMQTRVQR YNYLCRRAIE LSEEGSISEE AYAIAFRALV EALKNCVDVN  660
NSNNSMAECS TSICGLRETE SDNQGVTVNK TSKKRNTNKK RKVQEESDVL LAEAPDSLHE  720
MENLNTDGIT LNGYYGTQQN VQGLVQLNLM EPPHDAYYVS QPSIQGLGQL SSLAPSHDGF  780
FGTQPAMHVL GQVDFRTPST FNRSSPDQSH LRPTQVHGNS SRHP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C04090.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010049888.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A059CW520.0A0A059CW52_EUCGR; Uncharacterized protein
STRINGVIT_03s0017g01810.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein